SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W947 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W947
Domain Number 1 Region: 120-182
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000000000000017
Family PUG domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000191
Family Ubiquitin-related 0.0026
Further Details:      
 
Weak hits

Sequence:  K3W947
Domain Number - Region: 245-289
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.017
Family Rabenosyn-5 Rab-binding domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3W947
Sequence length 417
Comment (tr|K3W947|K3W947_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T001488} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTTAQLTIKLVSSGSETLALSMDNFADATVLALKQLIEAKDAARFPVAAQRLIFQGQILQ
NEKKLSEYNVVDGCAIHLTLMPGAARAATHAPTTVAAAPAAISIEPQLRAFLQQMRADSG
YVTAIQTMQKICENVINHPHEEKYRKLRLANAALKTRLLDRIRGTDCVKLLGFQEGVEQG
HLVLVPTAEKWDCLVTGKRVIDQALASSGSAGFNAAPSFGAPGFGAGAAAGNANWAAQAQ
SMLQNPMMAQMLQSDPMMQQMAQMNPMIAQALQNPSMLSQQLQMLQQNPAMMQQINQMMQ
DPNAMARMQQMLGGVSGAGGAGFGGGFGGDFGGGFGSSPFGAGAPSSGASNPFAPSAAPS
NPFAAAPTAAPAVTPTAPVAPAPPAAAAPAPSSAAADETTFDENEIADAIARSLQDH
Download sequence
Identical sequences K3W947
PYU1_T001488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]