SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WA47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3WA47
Domain Number - Region: 72-131
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000323
Family Homeodomain 0.096
Further Details:      
 
Domain Number - Region: 5-48
Classification Level Classification E-value
Superfamily TrpR-like 0.00382
Family SPO1678-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WA47
Sequence length 248
Comment (tr|K3WA47|K3WA47_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T001838} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSSVPKQKRKIDVATKLRLAQEAKASSINAVAKLYDVARENVRRWIRSEAQLAQLAQQQG
DAPVYRLQGGGRRISYAPMDQELADKVFAHRANGVRVTRRMIAEWAEEAKTRMQVDVVVC
PTWVSRFMARHSISLRKDGAIAPSDSVAPDQQKSKRSVVSAEDKLAIMYFFENSNRDMQK
TLLQFYGPIDDAKVKQVKARNIYNWLHKRDEIAAQAEKERVKKAAAEAAQQTKSAPRGNG
YFESGREG
Download sequence
Identical sequences K3WA47
PYU1_T001838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]