SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WAI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WAI8
Domain Number 1 Region: 338-384,428-444
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000235
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0045
Further Details:      
 
Weak hits

Sequence:  K3WAI8
Domain Number - Region: 60-79,120-294
Classification Level Classification E-value
Superfamily Bet v1-like 0.00137
Family STAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WAI8
Sequence length 713
Comment (tr|K3WAI8|K3WAI8_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T001979} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAKKHRRPPAVFPVADRDLPKIHVSREQHDELRAYVTQMSQEIVRDGPTWGRNIAAAEKD
GWKLASSTLSSYLFTKNSNKRVNRNYEDYSSHNYQQQQQQLGRKERDKPSHQAMPDSPPP
STTQCFMGHSKVPYSLEDVMNTLYCENTQDVRMHYANIYGSACLDCCTLATLEGATLDDP
FWYIGIRWLALKSPLKKLVSSRDFVFLEHTGTHVTHDGKRILYSVVQSINICAYGGKESY
FGLTRGHVETSFVFWADEKYSTPEKPVLNMSVKGRSCLNGSLPAWITQLYLKKFWAAAQK
LDHDEGLQGPAAHVAVSSGGISHMGGNGGAPLDMAVEWVPNEERTVCYVCNKKFQLVRRP
KHHCRSCGEVICSECTAYTQLNVGRRGSAPAAAGVHSTADTKDAASWTTKTSRKRRTRKR
DSDASTNAYVTMGKVCLRCMDLKTIMHNNSTNWHNYRRGSTDDTDVDTDITVMHGWQAEF
TPKFEELRTLTPERDSQRGVGTDGASSSKGDDKQSSSENSSGEKELLITGPHRESSLTSS
EVRAIIEQHGDDEDEMKRENRIDDDDMKPAAVAVDHGGYGGGAEDDDDGDFVLPEELEYR
PVVVAPAATPDHLLLADHHHLSPLSSTEAVSVVDDPQATSTMLMHKKLSHNRMLWSPSNS
PTNSATLSSASPSWSRMHSQADGRLSITDVRSAIADQTKILDEIKRELVADVP
Download sequence
Identical sequences K3WAI8
PYU1_T001979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]