SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WAS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WAS7
Domain Number 1 Region: 67-80,131-210
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-23
Family Canonical RBD 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WAS7
Sequence length 294
Comment (tr|K3WAS7|K3WAS7_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002068} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSSILASLDMSLDDLIAQKKKAPNPDSRAASRGNGNGNGKPRSNNKADAGSAGPVRGRQQ
RKRSGGARNQPYGRSRDGGDSDAMDVEDDGPQSGGKNAGSKKRAVVVKKQQGKGGKKGGS
ILSRLGGSTKDAGSPGTKILVKNLKFDILEDDVRELFGTVGEVKKAEIVYDRSGRSKGIA
RVWFARRSDAEKALKQYDGRTLDGQPMQLSLDDDANVRKGLFGTALRNDKDVKFKVSFGG
NSGDKDSQQKGRDGGRGGRGRGRGRGRDGQSRGNGPSKSAEDLDNEMDTYMKDS
Download sequence
Identical sequences K3WAS7
PYU1_T002068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]