SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WB93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WB93
Domain Number 1 Region: 376-464,521-592
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.66e-27
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 2 Region: 233-346
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000149
Family Canonical RBD 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WB93
Sequence length 601
Comment (tr|K3WB93|K3WB93_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002234} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAGRGRELTLPAWMKKQQQQAQAAPPPASHAPPPHFQQPPASTIGFHQYQQQQHFHAPPT
APVVPQQFADAPEQANGADRNGDSKHDVKKEDAGREKSGSRRSRSRDRRDRSSSRGSSRR
KDRNRRRSSKSRSSKDRSLPRDKDRSRSRDRRDHHRSRDRSDRRRSRRSYSRSHSRSRDR
IVRRRKKSYFDVRPPGVTEENAAAYAAQAILQQNMAALSGAVGPASFGPPPPPIAPPAHA
IVPGVVASHTFGGNSQQTRHARRIYVGGIGDVNEAEISEFFNDVIDRALGERQEGGAVVS
VYINRERHFAFVELRSIELTTACMNLDGVSFRGQPLKIRRPNDYNPSTVPKDLGPIPTLN
LAALGIVSTTVSDGPGKVFIGGLPYHLNDEQVKELLQAFGPLKSFHLVKELNSNLSKGYG
FCEYVDINVTDSACLGLNDMKLGDKTLTVRRAMSQENAKAVASAAGTVNSGLEMGLNPSH
AALQAMNLAGFGIPSMPLGTPTRVIVLLNMVTPEELEDEEEYADIVDDIKGECERFGRVN
SIVLPRPRDGFYSAVGKVFVEYGDVPSAQAAAAELHGRGFSNRTVAVEYMDEHKYARRDF
S
Download sequence
Identical sequences K3WB93
PYU1_T002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]