SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WBB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WBB5
Domain Number 1 Region: 11-184
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.05e-45
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WBB5
Sequence length 198
Comment (tr|K3WBB5|K3WBB5_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002256} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MRMEVATPIRKPRILLCASGSVATVKVPELALKLAEFAEVKLVVTKAGDFFLQKVSEYNP
SAWGAFTARAEPIEVIRDEHEWDAWRVVGDSVLHIELKDWADVLLLAPMSANTLAKIANG
LSDNLLTCIARAWNVRKSFVYAPAMNTDMWDHPVTARHLRTLGEFGYEMIPPVEKMLACG
VVGKFSRKGNLSRWARRR
Download sequence
Identical sequences K3WBB5
PYU1_T002256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]