SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WBI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WBI1
Domain Number 1 Region: 389-468
Classification Level Classification E-value
Superfamily Homeodomain-like 1.19e-16
Family Myb/SANT domain 0.013
Further Details:      
 
Domain Number 2 Region: 281-359
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000126
Family Myb/SANT domain 0.01
Further Details:      
 
Domain Number 3 Region: 225-296
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000513
Family Myb/SANT domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WBI1
Sequence length 548
Comment (tr|K3WBI1|K3WBI1_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002322} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAARRTGGSESGSVAAALGSNHALVRELRDVVSTLTEEETRLRLQMQAIRHRMAMRRAQQ
AMNAIAPAAARQARPHADTEIFAREPENVYKPVFELPRSYIRPRRSFFHDDDDPREVSIA
RKRGRKPKGYHEHVLQQKQAYRGSTVEDPSEPAPNADTLLLRQHSHEAFLAVPAKVFTAK
EREIVKTFGEAQLKLMGKSSDPNHIPEIPLSTWNLIAKRNKPPIHRTGFACKLRWELYDK
PGLRLCAWTKVEDTALKALASGEVDPSIVNKWDVISDRMPIPGRPPVHCLIRYQTKLCAS
NLNTTFTPEEDALIHEAIGVFGERWNIIADLMDGRVSEQIRHRWQLSLSPNVKHGKFSIM
EDRRMLLALYAYHDKSTPFQKESISWTDVCHHVPGRLQPPLRERFLNSLNSEISFTSWTK
QDDEKLLRVVKRIGLNHPGVWVLVAAEMGNRSDSQVARRWKFLAPEEYKKYQEEKKNAVT
LPAIFQRPILGRKRTRSAGYHAKRNSYNATTEESEQPSTSEQQSTPDDDDESTGNGGGRN
DAVYDILL
Download sequence
Identical sequences K3WBI1
PYU1_T002322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]