SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WBV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WBV4
Domain Number 1 Region: 88-135,166-231
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000199
Family Ypt/Rab-GAP domain of gyp1p 0.0082
Further Details:      
 
Domain Number 2 Region: 518-636
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000804
Family Single-domain sulfurtransferase 0.067
Further Details:      
 
Weak hits

Sequence:  K3WBV4
Domain Number - Region: 464-489
Classification Level Classification E-value
Superfamily WW domain 0.000161
Family WW domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WBV4
Sequence length 877
Comment (tr|K3WBV4|K3WBV4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002445} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MASAAETTRADALRRVLMRQRLRIWAAKSAQERREFGDELQQLFSSPSALSTASNSSSSS
STSTGASPARAAITRRPGVEEVKNCILANVYAGLPPQCAPLRGEIWQVLLNVYKRNQHGS
SAQEFDRMILRLGKLPRDPLLVEECAQVSALLLPESDNVEGVMSLSTSADEEKERIQKEL
EILLVWFLTTKSVAYTSGMARVVAPFFLLNLPLPTIYDCFYQYCANFLPHLMNADADLFS
QVDSTDGVTETASETDSIAGAEAEENKEETSTASERQHLAEQLLSYHDPQLAHFLTQWCG
NEWSKPGQVIPASFFLGDLYQDISPRAYTYVMDQILFTGDTLFGMFVLLAVLIHQKEALM
ECMTAADVKSKIQSTFGVAFADETNVQFLCLLASRLRSRTPRSYTCLLGEGGPTTHSPSR
LATEIAFGMTPSSKHSATSTPPVSSDNKKVDVDMTQWVKKESRSIAGKIFWYHTQTGKTQ
WEHPAEKHDPAPVLFALPISVDEVAGQVMGEKTSEQSQGLRFFVIDCRGLRSSDDLKSGR
IPAAYTLDPSVFDSPDLIAKNMEALNPLKSQVHIVLAGHGVGVPPELTTTEELKTSVRDA
VRHDTDCINRAAIFFQKRGFRFVSCLDGGYSSWHAFMRDNAACSPQELLNHVESECHYCR
YDTILRTGEDPFKKKAQQNKTRRKKSAMPTTTNMPVNGGQGDASIISTSSMNNNSSSSSG
SSSNIGSGNRLSMTALSRTSMSSISSMRTKFADVKMPKLQWGRRSSATSVASSSASNSNN
HHDSGSSSETATVDDGGSDRGSSATDDLGEEKPDELDESLEELQAKLEAQVSPGERKKSF
VGVFTIDYSDDEEEHESAGASTEAPVVASTVAPTQSA
Download sequence
Identical sequences K3WBV4
PYU1_T002445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]