SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WCC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3WCC5
Domain Number - Region: 9-51
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00158
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WCC5
Sequence length 58
Comment (tr|K3WCC5|K3WCC5_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002616} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
METLSCMLVGTERDEFCIDIGMSETVAHLKDAVKKNKELDFPASNLHLYMAKRNNKWL
Download sequence
Identical sequences K3WCC5
PYU1_T002616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]