SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WD99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WD99
Domain Number 1 Region: 97-172
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000442
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  K3WD99
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WD99
Sequence length 406
Comment (tr|K3WD99|K3WD99_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T002940} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTDDATAGDNGAAVITIADNEPTSQLQALDAAVIDVSAAAEEGKRNDDDDDDEVEVIDDA
DTTAAANAQHAGTAAEQTAAPGRTKYEDVVLRHARNAKKLEEELQCVLCHDGLFKPVTAT
CGHSFCRVCLVESCLSRALDEAQCPVCRADVMSHFSENTPIVFHVNVTLWNLIQLLVPRE
EHKDYEHEEQEYTLKLDQLDAKWRIQSLRAAAEHFHREREGTILGTLDDDEDEDYVEGED
DEGDDDEDDSNDDDVDIEGEWYQDDDDEEGARRGGSFANSRRRQRQLEERRRSRQQRNRY
PELKVENMVDGRLRVTRNVLLDTEDANEDGIISMRVGLALVEFPSILELYSEHQECSLAI
LKMEEDEEMDTGFPFFMNESGDDDALVISDYSNEITLKVFDDGVRG
Download sequence
Identical sequences K3WD99
PYU1_T002940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]