SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WGG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WGG7
Domain Number 1 Region: 65-116
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000163
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 141-201
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000186
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WGG7
Sequence length 681
Comment (tr|K3WGG7|K3WGG7_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T004058} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSASLAAGERDAGARPDDNGDEQEGSAHEIIEVGDDDEEEDAEDGAQNDEDADDDAAVDD
VEADACCICQDIVELLAQGFLPSCEHKFHFECIVTWSKVTNLCPLCKQKFNTVTRVDANG
SIIHTEKVEDAKQVFRPDPRDHDIAAQLRLVNEARCETCGRGDDEHVLLMCEARGCPISN
HTYCIGLSEVPASSWYCSRHTDMLRASDLIERPATTVSSRRTTRRLASLMSNILRGSNRS
SSGTATRRGRGSSITSSGERGGRGRRATARVTLESESGRPIRGVAAVYAMRMSRELQQIQ
QRADVMYARGDHYQHAPSNRQIALSRSTVPAHSSVDLMWQDHDSSRQAMATVPSSTLISS
MGSPQPSSTNRISRTLAPEYRALAQLMVDAVASDNYASTVSLVIPKTAKLRLVSKVKTFF
ARLNDREKLAVLDMECLPVLYKWIQKADASAAASPHPQVLAAVLTVVESLPVRKSDLIEV
PDFRSTLNEIVTFPNISVELRERAIKISEKWREINPPPRSASPPRRPQYRPTPFDTGRTP
ALPPPIRSFSAQKQPMRREKKEKTRKQDAWATPAVEYVKAKLYPLYKHGNGKLTKERFKV
IVKQVLDLFKVEAASLQSELVLPSGELTNITKSRLKTLIDRVYKASSNGISTSASSSRSA
ASASSSSSYSALPPTKHRRIS
Download sequence
Identical sequences K3WGG7
PYU1_T004058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]