SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WGV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WGV7
Domain Number 1 Region: 519-676,705-861
Classification Level Classification E-value
Superfamily SAICAR synthase-like 8.5e-69
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000962
Further Details:      
 
Domain Number 2 Region: 194-484
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000183
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WGV7
Sequence length 920
Comment (tr|K3WGV7|K3WGV7_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T004198} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSRSGGRTSRERRGTPVLEEHPYINTLSPPSTSLYVMETPAQGLPETGEGEQHVLHHVAS
GSGFIDPQAAAGTGVFRRTMRYPASETGSVNNASYTYAGSVASSVNNMDPLNSTSAQQPL
ITTPRATQQNFIRVINKDMTEQFRGRSKSVPNARIKWFENRKSQLLGCCLTMAFLGLSIA
LYDFRWTGLIAGSVNTLICGSAVVMTYCRKKRWHQHPNPIVHIRSVLSMFLAVCLLLNVW
VNFDPTSDNNTNCQGLAGITEFFFFTSEAWGLVMACDLFFSVTSPFTSYKRLMRFYHLWV
WLGGIVMGSITYSVKGAGGFFTVDGQSVKYHSDIDNVVGFCLASSRICCESGQTCADDVE
MCASNSSFLNTQQWPWILIYCFVILVLFVSVCVLTLAWHRLYLRGVPKTYNIRLRVLNYV
SFFIGAYVFYWLLLLLLYMCAYFLSTKSDSSDSKAVAQVLRQLVIFLISSKGYLDYVIWF
AVNSIERRSPNSRHQDDESADVDVDLSPQVNAALRSEILYYITSGIKESVRAVTDELITI
PISGEGEKGKSVKFWSFCPAAFRNVRLASGISDSEYIQMFGATTKERFSEGRSGAFMFFT
ADERLICKTMSPEECTFLRKMGLNYEAYMTSNYNTLLTRFYGCHGVDLYGKMYYFVVMGN
LFADTQIVHHRYDIKGSWIDRNAKVPRPGDRTTCRYCNAAYTFGSTRNQECGDGLNFHEP
NIVLKDNDLMTKIRIDPSQAHKIYDQIHKDSDFLCSQGIMDYSLLMGVQSSEYMVDASDL
LPQRSTMGKQDENLFTQVATSVSGPSLYHFGIIDFLQQWTFEKKMERFYKCFFKRKDPDG
VSAMPPKPYKFRFQQKMSRIFALNSHTRTNTLQYQRNQPALIDVLDQTDFNTQRNGTYVS
TGDDRRGTTQFNPDHDVRFA
Download sequence
Identical sequences K3WGV7
PYU1_T004198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]