SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WHX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WHX2
Domain Number 1 Region: 289-351
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.96e-17
Family Cytochrome b5 0.0031
Further Details:      
 
Domain Number 2 Region: 189-274
Classification Level Classification E-value
Superfamily F-box domain 2.62e-16
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WHX2
Sequence length 417
Comment (tr|K3WHX2|K3WHX2_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T004564} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSALPAPRPVAYCRSNSSSNDEAVAVAGLGLPRMPVLVNSPRHKEADDATAPVVVVPPNV
TKGNRLVQFMVFSAVACTLYQFVTHGSSQLTMKTDTTVGAQFGSSEYTCILACMGLFGLI
RHKAKEAKKRAVDEEVEDEDDELTRELRLTEKLVRNQRKHTGKNENVAAIKKNRQSPTNA
CKNAVADTDVLSNQQQPPGIEALPLDVLHELLLFLSPKDLAACPMVSKQMNVVTGDASDS
LWRLVFQRDFEETGERFQVVFPIESWRQFYFQHHLSRAVEIARLLGLQEDKKCVAIEDHV
YDVTAFLHSHPGGYHVIGDVIGTDATEIWDQFQHSQEAKESMKEFMVDDPILCNREAHPR
LHGNLAIVITRWQRISWCITNAHNFGPMASTFTDVVLRFHARSIKKSRDLATPRVSN
Download sequence
Identical sequences K3WHX2
PYU1_T004564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]