SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WIV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WIV9
Domain Number 1 Region: 45-142,218-245
Classification Level Classification E-value
Superfamily Cyclin-like 5.39e-24
Family Cyclin 0.004
Further Details:      
 
Domain Number 2 Region: 249-350
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000707
Family Cyclin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WIV9
Sequence length 391
Comment (tr|K3WIV9|K3WIV9_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T004901} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAIESLDKWVFPAFRAFVLARPSGSAASQTPPQSDDHAPYSDVTPTASQIPWDVEQQLRR
TTCEFVEDLAAIVEIPDAPTVAAQLYVQRFYMLHSFQQHDRFLLATAALFLAAKTEEFPI
KVRLLTECALYLLLCKHPDRDELRKKSSSKRRPTLDTRNIAGSANGRPRSQPPSMTSVSR
RKNSAGKVVEMSASLGNDPEAANARHLDCLHALLEVIDVGEVETTASKVLLLERILLQTI
SFDIGIPQPFAYVARAMVKVFALEAIHPSIPYDDIRELAFLLLSDAIKSGLCLAFNPAEL
ATGAVYISCLYRCSVSPNVATDTNDPWWSVLGLSSQQLECVAHGLLWMYEDASGHQRHGL
SPQFRDLWARYRPEQNLPDLEYIKKLDAGLQ
Download sequence
Identical sequences K3WIV9
PYU1_T004901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]