SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WKP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WKP0
Domain Number 1 Region: 610-744,774-962
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.53e-75
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000049
Further Details:      
 
Domain Number 2 Region: 249-502
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000128
Family Rhodopsin-like 0.019
Further Details:      
 
Weak hits

Sequence:  K3WKP0
Domain Number - Region: 748-771
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0746
Family HSP33 redox switch-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WKP0
Sequence length 987
Comment (tr|K3WKP0|K3WKP0_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T005532} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MNGRASAYTDRDSTRSSDGVIERHPVHLPHERSFGRTPGRGPAPPPPLGPPPIPFEVSST
TSSSSSSLPGFQDQSPVRRPPTTRGGKPNGSSGLHLPMADSLSSTKNKPSPVNAPTTFTS
SMLSGGIPATGTGNGQGASTGPGGSYTSMQTPIETKKKSPAMPLDLQVGRDRLDDSSEDS
YDNGSYLSEKIPGGPNGDGDGWFHAKIKVDSSIQWANNYKIQLFMFLMLVGGVVVTLVFA
NNSAEASVGLFCGSIITLISCSSVVYTFLTRPTWRKHPNPIIFFRSLCDIGLVSVLLMTE
LYKCGTGKCRATLGDASCSATAALTQFFLWSSESWFFVMAIDMLFSLQSPFTDYKRNVRR
YHLFVWLTAMTTAIILVSIPDFAGPSEFGYCWTDSKSKLRNNKPDITEGENYLWKLNFQS
WALFYIWLILFWCYAIIVIYWAYKRLHSGLSETLRMRLRVLHSVTIYVIAIIIYWAFTFF
VYVPYLIQTKKTKEVTQMMNFMITCKGYFDFAVWFQMNEFHENLSKGDAKKTDIDVDVDL
SPQVNIALRCEVLYYTTTGIIQAVRDTQHLPPGANQQELYLQPQGTEENRASLGVDEYMI
RTRPKAALSKGTLFIDYCPHTFQTIREHFGVDTNQYIESLSRTTKERLSEGASGAFMFFS
HDQQLIVKSMSDEESAFLRSIAPEYASFLLTNPDSLLTRFYGCHAIRLYGKTFNFVVMAN
LFSTDKIIHRRYDIKGSWVNRSAKHPSKGKRVTCRHCNAKYVFGSTDAENCPAQVGRHEP
NVVLKDNDLTARVRLDPKVAEELYDQLVKDANFLSRLGIMDYSLLLGVHNVEYMVNPDLA
EEMEESVPALGGLQGKNRNSTQTDLTHRSGKGRASNPTANSPPRTKQRAGLPRLGTGTRR
ANTVVGPSIYYFGLIDILQQWTMEKKMERFAKTKLLGKDTDGLSALPPTAYCDRFKRKMG
EILSVTIRNEYDEIYDERRSDGHRRFM
Download sequence
Identical sequences K3WKP0
PYU1_T005532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]