SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WLJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WLJ0
Domain Number 1 Region: 103-181
Classification Level Classification E-value
Superfamily Homeodomain-like 4.39e-31
Family Myb/SANT domain 0.0029
Further Details:      
 
Domain Number 2 Region: 15-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000166
Family Myb/SANT domain 0.02
Further Details:      
 
Domain Number 3 Region: 77-116
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000609
Family Myb/SANT domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WLJ0
Sequence length 407
Comment (tr|K3WLJ0|K3WLJ0_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T005832} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MERRFSPYQRRSQKKPKPNSLSQVEEPWTSEEDELLRGAVYKHGGKKWKTIATFFNKRTP
AQCNFRWNELQNHGTAVKKPWSPGEDLRMLELVESHGASKWAVIASYLPGRNGKQCRERW
HNQLNPAIKKGPWTPEEDEIIMEMQAKYGNRWAKITEKLPGRTDNAVKNHWHSSMKAKYK
DILHPSTSPTEEMSCTASEIFGLPRDVIDDINDPLSIMHENTFVDAMEPFPQETAGEEFP
FLPEYGSVESPTSHDAVYTDEAFLNCMSSDFGNELEYPYTPAVDFEKDQGSSMSTCTECD
EVLESVDELCANDDVLRGEIAMLKTMYVNPEQGNAAATLGLEWSEEAQYPIDFLPGVLPP
YTIDDCLVDELPVLHAEAIDDIGMDQVAQPVACPPEDEGSFQLVVTM
Download sequence
Identical sequences K3WLJ0
PYU1_T005832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]