SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WLK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WLK9
Domain Number 1 Region: 292-536
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-46
Family Regulator of chromosome condensation RCC1 0.031
Further Details:      
 
Domain Number 2 Region: 106-180,219-267
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-23
Family beta-lactamase inhibitor protein-II, BLIP-II 0.063
Further Details:      
 
Weak hits

Sequence:  K3WLK9
Domain Number - Region: 43-84
Classification Level Classification E-value
Superfamily SAP domain 0.00755
Family SAP domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WLK9
Sequence length 684
Comment (tr|K3WLK9|K3WLK9_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T005851} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MGLLRRKKLDIRVPMGKNAVNFRKLLFLPIKDTQDLLANSEWECLDLRCLTLMKTKMLRA
SCIARGLPKKGGKKKLVQQLTASLSEQKHAEFLRRQEEEEEYQCQLDMLGGVWSFGAGYS
GQLGHGDMESNGTSRLIKKLRGRGICQVYAGFDSDLAFAISRTGDVYVWGKRSAPTGLPP
GSSFNALVKKTYPKEDDFDSSEDENDDEEGQDGDEEGGSEDFVDPVKLFALCGEGINHIA
VGRVHCCAKTKDGDVFTWGQNDHCQLGKEPVHILSEAKSKKARVRYGMGTHEPQLWERSI
PETCVIKAVDVGTNHTFAVTDAGEVHAFGATFHTSDHSSLTRSLAKLNVVQMSCGAMHAG
LVTSNGQAFTWGSGDGGRLGHGDTTSYMNPKLVDVLKDDIIFDLSCGCWHTVAVVLIPPL
LKGGLVYTWGSGRLGQLAQGGKQISPSPGLVTDLLATHALIKKVCAGMYHNVALSVDDEV
FTWGSNSNGCLGRPEELAGLEEGFCAVPARVEGMEEFVGRPCSIACGKEFTLIATKPYIG
PSRKELERRQEIQAEQAQSIKRQSKNVKKEQEQQLERIRRDKISVIVTFLNATYPKCSIC
TIGTICPGFQRDSINPAMCKHCMHERRKHDDLHKQNERRGTIPHLKYLEEIINKLAVSID
FSEVADIELEAALEEALEEALEEE
Download sequence
Identical sequences K3WLK9
PYU1_T005851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]