SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WML2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WML2
Domain Number 1 Region: 107-191
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000000262
Family DNA polymerase beta, N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WML2
Sequence length 195
Comment (tr|K3WML2|K3WML2_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T006204} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSREASKKAAKELLELCGKEGVKVPTEMITKFGKKESASKKRKADDVKAEKKPIAAKSRS
KKADDAEGDEHGKKAPSVRKTTKKTPAVISEDDEDDDEPKTKKARTKPTATNEANQELAD
AFAELSGFEFKRGEKFKGGTWSKVAKAVRDSEDKITSGKQAMKLKGIGKSSATRIDEFLE
TGTMSTLEEYRAGNM
Download sequence
Identical sequences K3WML2
PYU1_T006204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]