SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WNB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WNB4
Domain Number 1 Region: 8-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000135
Family Myb/SANT domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WNB4
Sequence length 184
Comment (tr|K3WNB4|K3WNB4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T006456} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
METLSTVATERGVWSEDEHDRFLVGLQMFPKGPWRKIAELVDTRSARQVQTHAQKYYKKI
ERRVRGFRKDRKHVARSEHRLDQDAMRKVKIAQCVTEDIREIFNTTDLPGTTRNGESEEL
LDSKQDEVLQRCEGNLLKCDDSTMWNSGAIDTDDKDPLPDVDDCCLAYLIQILDSSDTTK
DECL
Download sequence
Identical sequences K3WNB4
PYU1_T006456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]