SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WNC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WNC8
Domain Number 1 Region: 12-61
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000012
Family Myb/SANT domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WNC8
Sequence length 203
Comment (tr|K3WNC8|K3WNC8_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T006470} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSTAKINSNVEHGVWSEEEHDKFLIALKVYPRGPWKKIAEQIGTRSARQVQTHAQKYYEK
VARRVRGLRKDRKRLVRPEHRLDDDMATLCKVAENETCGSRIGPIRNGLNAVRAIPREVF
TSGQDHVDARGECFNLGLDAIPNQNRRDSIESLLEEEDDDDCDDGTVMSGITESDGNDSL
LDIEDTYLDYLIAILDCCEMDPC
Download sequence
Identical sequences K3WNC8
PYU1_T006470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]