SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WQ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WQ87
Domain Number 1 Region: 167-305
Classification Level Classification E-value
Superfamily TRAF domain-like 2.13e-20
Family MATH domain 0.0035
Further Details:      
 
Domain Number 2 Region: 65-156
Classification Level Classification E-value
Superfamily F-box domain 2.22e-16
Family F-box domain 0.0035
Further Details:      
 
Domain Number 3 Region: 626-678
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000424
Family ZZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WQ87
Sequence length 722
Comment (tr|K3WQ87|K3WQ87_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T007129} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MALFKTRASVNCVEIEQHAQLLLLQREEQFYQQSPTDATAMIMDDYEMVENENEEDADET
ILLLSPAVAPSTVHTLPQEMLQHVLRFLDGGSLLACALVCRAMTPLTYDRDVWKNICMQQ
WPTLQTQFLPQLPGAPDYDLIRLYGGCWRRCFVEQHQFNARAELRVQIPQFPALAATTDV
DKIVSETFSIGEHRFCLWIFPNGNPNEPQYAGKVLSVYLVLTDLERRAPSWLTCAVFSLS
VVNHVDPSKRIEWHSCLVDNKFDHQLNNWGVHSLGALKNLTNPENGFLQHDNTLTVTAKV
RLMSITFRVVREHDMKRHHHLGLTDLARVDTIELPFCCTLQDLLKALHTKYDIESDQVNV
WCFNQPVVSGQALRPRKLLTHASVDPRQPMFSNLLCDGVDIDAYSFCQIYVESKVDDDAP
LECATIATLYSSEDGISSAMDMETDSTVPCANGHDRGYLFVKIMDPRTQQLEYLGRINFA
AHLTASMIYECVAKHVGCASSELLMFKEEIAPTVVSGPIVSSDKPVMTAQSGHACDDSLL
HPTDIVIFTLRDHCAQNAFVATMENLLWTQYAHAESLVQDSFAVPTLEQIETLAEKLDIP
KFRVRSAFRKCNEDGRRTLKYIMEGRHLGFICDSCGETDFKGPRFNCSLCADYDLCRACN
AQCQEVNHRYANRDGKWQRVYDFKEHKMAHQMREMMPVFYQYRPDKNGRLHDPEDAIFMA
IQ
Download sequence
Identical sequences K3WQ87
PYU1_T007129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]