SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WQ99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WQ99
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-18
Family Canonical RBD 0.0011
Further Details:      
 
Weak hits

Sequence:  K3WQ99
Domain Number - Region: 1-42
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0545
Family Canonical RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WQ99
Sequence length 180
Comment (tr|K3WQ99|K3WQ99_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T007141} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MDGRDFLGGRIRVELARGGSRRDDRGGRDGGRDRDGGRGGDRFERNARTPPTRTEFRVRV
SDLPRGTDWRNVKDFLRSGGEVTYCNIESDGTALAEFQSKDDMENAIKKLDDTEFRGNYV
RITAEGSDRRSRSRSPPRDRSPRRSRSRSPAQRKDSPRRSRSRSVSPAAAHSPPPRKNSV
Download sequence
Identical sequences K3WQ99
PYU1_T007141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]