SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WRW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3WRW3
Domain Number - Region: 181-260
Classification Level Classification E-value
Superfamily Bet v1-like 0.000183
Family STAR domain 0.025
Further Details:      
 
Domain Number - Region: 295-366
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0242
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WRW3
Sequence length 557
Comment (tr|K3WRW3|K3WRW3_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T007707} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MKFPTKQRLLPELTLSESEQAQHVTLAKTLVARTIAQYEDYDAVYNRQVSREQWKPVKHR
ESLTVYKQKKWPRPKQMAPRHGAHSSSSSNSSASSSARPQTTWSVPTLFMVGTIVGTLDD
VMYGVATFDAPSMLLKTTYTHDELVDGEILNQIHGPTGDDPFRFLGLKWIVKGSPAAVSK
IVRPRDLVFLESTGIDQLENGDRVGYHLMHSVDLPGYGPLQNSSILRGRVSSCIVFKELE
NGTVDVYMKANFEPNGKVGESVAVLSAANGLIYCSRAVYCAQHKKLAWLLTNRYKRAASV
ASDLRHCDCATCGKSARKFRRQLTTCQLCRGPMCSTCRVVKRISYIGSGVKEIDERVVPF
CKGCVSSTSQKSAFTIAKEEVLSGRWERGGNGVMTTAAMMSVFGLPSEEAIESSSASNMS
SRNGRSMSATSRTASAYGDPIELLDKAKYQNLLVPLTPSMPDFKRTFSAYSSCDEDSIDL
ALCYNEYDDASDVESGSTLDLDDVVEGVPVDMGTLAPQDELYLRMALLRDAAETTYNIAM
TNAAAHMTATSSTRGFI
Download sequence
Identical sequences K3WRW3
PYU1_T007707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]