SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WS62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WS62
Domain Number 1 Region: 139-491
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.99e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000292
Further Details:      
 
Domain Number 2 Region: 33-122
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000245
Family Anticodon-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WS62
Sequence length 496
Comment (tr|K3WS62|K3WS62_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T007806} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MDAQVPAPAKTVAPTLFRRSRIRVKELLARGLELEGQSVTVKGWAKTLREAGAGAFAFLE
VSDGSCFASVQVVITRESTEGFEAALESGGVGASFAVVGTVVKSPAKGQVIEVKADKVEL
YGGIPDPATYPMSKKRHTLEHLRQHAHLRPRSNIHGAAMRVRNAMAFATHEFFNSRGFLY
IHTPIITESDCEGAGEMFSVTTFLSKHPDGKLPVTKEDNKIDYKADFFDRPSYLSVSGQL
NVETHCCALSDVYTFGPTFRAENSNTSRHLAEFWMVEPEIAFADLKDDIDLAEDYLKFCV
QYAIDNCADDLDFFNKNVEKGLLDRLANTIAAPFERISYTDAVNLLCEPEHLKKGKFSVK
PTWGTDLGSEHERYLTETVFKKPVVIFNYPKEFKSFYMRLNDDGKTVAAADVLVPNVGEI
IGGSAREERLDVLEQRIIESGANPEDYKWYCDLRKYGTVPHAGFGLGFERLVRFVTGIEN
IRDVIPFPRWPGNAAF
Download sequence
Identical sequences K3WS62
PYU1_T007806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]