SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WSU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WSU1
Domain Number 1 Region: 232-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-21
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 129-218
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.3e-21
Family Canonical RBD 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WSU1
Sequence length 362
Comment (tr|K3WSU1|K3WSU1_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008035} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAKSKAVAAAANSSGKKRSRDATEDKPPKAAAVVKDESSASSSENDDSESDDDSDSETEN
TLFRPAPVTRNESDGSSSEEESSSSEDEEEEEEEEDTPVKEEAAPVKKPTDKKAKPAADV
SDVNVESNIQEEMDKKTEATVYVEGIPYQADEGDVVSHFSVCGIVKEVRMPRYQDSGRPR
GYAHVVFESEKAIPKALALDGKYLFKRYLSVSRAQTPRTLELALKETKNVKKAVVGCKTV
FVKQLPYDIEEQALRDALASCGTIMSVRLPIWNHTKKLKGFGYVEFSKEEEAVAAVKRSG
MKVGGRMVIINLDVAGAPKASFRQTDGQYWNKTEEAKKSLAKKLSEKQQRSGATNKKRKT
TK
Download sequence
Identical sequences K3WSU1
PYU1_T008035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]