SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WTG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WTG8
Domain Number 1 Region: 6-284
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.69e-56
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 296-490
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.27e-29
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WTG8
Sequence length 491
Comment (tr|K3WTG8|K3WTG8_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008262} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSSARVVFLTLNDVYELLPDDDGRGGIAEFATLLKSVKQRVASDPLTRIIVTLNGDFLWR
SELNRRDKGAHMIELLNYLGVEYVVLGNHEFDFGEVTLSELLPYAKFTTFGSNIRLRSTG
SLLDHVTDSVIIPLANGLHLGMFGVCTVTTATDSFPSKDVLFESEVDHAARCVRELKAQG
ADLVVALTHVRLPVDKLLARQVSGIDLILGGHDHEPMTMFHGNTLIHKSGQDALWLGEIH
VDVTRSHISKNKPSIAFSWTMHSNRGYDLDPACVSILSSYAARVTQEEIRDGRRFVLGIS
TTLLDGTRTTCRTQESNLGNFVTDAIRGTFDTADIAIINGGYIKGEKLHNAGLKITRKWI
SSVLEFPNASMLIRMRANDLRAAMLNMFSRYPDLNASFPQISGIYTVYDASQKKKSLRLY
RDANHADEIADNDELNVATSEFVINELPGFNRFELVLMAKGPVIPDIVADFVQKEEQIAY
PLRENRIVIID
Download sequence
Identical sequences K3WTG8
PYU1_T008262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]