SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WTR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WTR1
Domain Number 1 Region: 342-546
Classification Level Classification E-value
Superfamily PRTase-like 0.000000000102
Family Phosphoribosyltransferases (PRTases) 0.004
Further Details:      
 
Domain Number 2 Region: 175-226
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000211
Family Centromere-binding 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WTR1
Sequence length 547
Comment (tr|K3WTR1|K3WTR1_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008357} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MMVGTPTLPTLSSFLRSSSMSTSSMSSSPPRMSLSGSSASLAQLNSTRSATQAAWRHKYP
LRQQQAFPALMVQSMEQHSRKRKQPISSHDPLQQQRPASSFLSSPIGSSLPRVHDTSSVH
QWQQTQQVRTGSNNSFTKTTTNTTTNTNTNSNNATGQHPRLAVAHPLPPVVQRERTSRYL
SEGDRRAIIRRIERGEKQVALAKEYRVSRAAICNLYKNRKEVLTRVDRDPDAKHPKKHKH
KPLAASPEITPSLPTSPVVLSVDEEQHVEEEEEEEGRELKEEEHGLRYQHQEQLKRSSSN
GSESMESDSFRHRSHSPEPRVDRPAAPPKPFHVRDVATHSLPIKNLLRTLRNGDTESPTF
RHTANRLMRMLIEEAVAYVQHSQDNDVDVKMGSPSRDSFPGSGSGSGSGSAVVDERDICA
ITMEEANGASVLLRALTDVLPLASTGAISLTAEDVHSRFPPASHGRRWHIRAQIPERIDP
HQVVLLLDLLCGTGERACSTLQYLVHEKRVAPSSIYFVTVNGSVSGLQNVHHYFPDVALI
TAQMDTN
Download sequence
Identical sequences K3WTR1
PYU1_T008357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]