SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WTW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WTW4
Domain Number 1 Region: 22-226
Classification Level Classification E-value
Superfamily Bet v1-like 5.56e-34
Family STAR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WTW4
Sequence length 228
Comment (tr|K3WTW4|K3WTW4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008410} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MKASNPAKVYKSVEDVDFHAFGEDSVQILLDRQSGQDKLTTWNLVDSQAKGGVKIWKGQV
QGSSWSPFKVSRHINADKATIQHALIDPDLLLKMDDMTSSVRILKSVDEEGKLTLRQLAT
RAIFPVSAREFVIVTYATTLPDGRMIIASRSLPLEGVQLTDGAVRGITVISGYIIEEVKS
ASGKPCCDVTLLAHADLAGYIPSKIVNLLGTSTTVKILANLQTVVERM
Download sequence
Identical sequences K3WTW4
PYU1_T008410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]