SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WUB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WUB5
Domain Number 1 Region: 56-162,206-587
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.83e-81
Family Trehalose-6-phosphate synthase, OtsA 0.0000799
Further Details:      
 
Domain Number 2 Region: 634-650,698-924
Classification Level Classification E-value
Superfamily HAD-like 3.7e-24
Family Trehalose-phosphatase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WUB5
Sequence length 1057
Comment (tr|K3WUB5|K3WUB5_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008562} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MKPQRRTTSSLQINALASGAPQAAASPHLMQRPTSPCFLAPQPLESPMTSRKPKTVLIVV
NVLPLVFARNAAGTAWVVEWSSSATSMFYRNLVSETDKYSPLFIGCPEVFVAKSEEAVVE
KQLRAFHCAPVFLDPTVAHRYFQGFCKGVLWPVFHNVVDVYNSAKLTLDEYVVDCEESAG
GDKNKERRESSGTNCWRDPASWNPAAQDKCWSDYCSVNRTFAKRIIESYHDGNLIWIHDF
HFLMLPSYLLRKVRTALVAIYLHAPFPSSEIFRCLAVRTEILRAILCADHIGFLIFEHAR
HFLTSCKRLLGLNYTTSQNGMLVIEYNGRKINISCSHIEPDVSHLHDILEHVDGDEDALS
FKKKIEKHIYDGDNKRKFVIASVDRLEGLTALPLKLRAFDRFLSLHSDKRKSVVLVQIGL
SLDSRPNDYHQTREYVLKFAAEINRRWAPPGELVVYFEEKVKTTCMERMNLWSLSDTYLD
TCVRSGLSLLPFEYIVAQKHKKEHMPDSSWPFGSMVVSEFASYSRILNGCLLVNPWKTDD
IVNALVKATEMNYYERHNRFQLNYKFLVMHSEQKWAERLLSDVESAVCKKQATEARETID
VGFGFDYRVMQFETGFVQLDLDDLVKKCTKSCRRLFVFDYGGTLSWTTSILDEDGAASCH
RNGSVDGVMACSDLGDRKTAFGQSVIRYIDGQVRTPLSDEARDNIRTLCNDPLNIVFVSS
TGRRAELDAEFASIENLNLISDNGFFLKKAGSTQWECLYKGVDLNLDWKDEVKRIMQSFA
ARTNGAYLIVNEVSLIYDYRSCDPEYGEIQSLELYEQLRQVLKKGDATVYRGKGFVEVHQ
FGVNKATAMTLVLSYMKEKVGVPDFVFFAGDDESDELAFKVLLTFAEHESALEHMFTCTV
GMKPSCAKFYVDSVSDILAAVHAIAVRLRLESSRPTLFSKQSYFDQFVAQGPLVSPRFIR
SLSVETDGTELLDALVPPTASEHSIDTFAFPQPPTPTTSAPTPVGPLTSLTSLVPSCLAP
HISSEWVILGAAVGIGCAIGASAISVHEKLRRFKLLS
Download sequence
Identical sequences K3WUB5
PYU1_T008562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]