SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WV08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WV08
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000353
Family RING finger domain, C3HC4 0.0024
Further Details:      
 
Domain Number 2 Region: 99-159
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000752
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WV08
Sequence length 161
Comment (tr|K3WV08|K3WV08_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008805} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MADEEEQDCCPLCMEELDITDKTFDACPCGYQIKNEYNGLCPACRTPYSEISKQKNTLDR
EDVVRRTKQRKQKEKSDRRNAAQSNKQTINRKNLANILRSLDCFGQYGKIIKAVVNKSHL
STDRSNATASAYITFSNKEDALACIIAIDGYYLDGSLLRPG
Download sequence
Identical sequences K3WV08
PYU1_T008805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]