SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WVD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WVD4
Domain Number 1 Region: 106-289
Classification Level Classification E-value
Superfamily Macro domain-like 5.05e-48
Family Macro domain 0.0000773
Further Details:      
 
Domain Number 2 Region: 303-615
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.01e-20
Family Sir2 family of transcriptional regulators 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3WVD4
Sequence length 964
Comment (tr|K3WVD4|K3WVD4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008932} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSHSELAAKYETLVVSVAKSLLAERGYSQHHIEGEATGDVREIVQQLLIMRPPPDDNVAD
TEEALYAQIDELLELEQRRQVITDAHALPSVVDDTEAPANLVPWNQIALWKGDITTLNAT
AIVNAANSALLGCFQPTHKCIDNVIHCKAGPRLRAACHDIMSRQAKEEPVGQAKITPAFV
LPSKYVIHTVGPQLRRGQSPTAAQRAQLKSSYTSSLDLLLETVGRDTQASIAFPCISTGL
FAFPSDVAVPLVVNAVVEWLKDHPETSLWRVVFNTFLQHDYDLYKQYIESQHAGLSLPAP
TAVPALETASKLLEEADYLLITAGAGLSAAAGLDYTSEEVMKKFHPSLQKRGLRTMYHLV
GRTDFPLEFFWGYYFTQINNVRFNWTKHRTAPTYATLKSIQDCFERKVQWSTFVATSNAD
GMFGQEGFDLDSVYTMQGDYGYLQCKTPCSRESVFDMKPFIDRALPHVNPETYHIDSEEG
MPKCPNCGGDMYLSLLYGSRSLEKVRAKQRKVYQQWLSNVLEKVRTEDKKLVILEIGVGF
NTPGVLRLPDERMATINGVSLVRVNEAQADIPFDSNGLGVAVDANDALEFFQRKLIVAFL
VPRLRDSIPSVLRRLHAQCLLMHENQAVCLRAHTRLQRVWQELQFMPTARELAATLPVLA
IYGELLTRFERILARFAVDDAIFRLMLSRQFFVKMDQLHRGVSIVVQAQQQHYHHQIALT
IETNGRDALRLWKLQWDADRRVQQVLDQQRSGYAAKVSKEQNAIGNEVKQLCAMRDALEA
AAGAVDATSKPAAVAIFVSINGDEKLNQVVEISKWEIVALQSGEASRLGCCSTMKSTKVE
AACEVSRCAAQTTKLSDGAHKDYGAASHLQGCRLVRAHGACHLCIPVYFAFQDMESASET
LFDAFVSSHDEQLVRFFYQVELSLHLPHENQAFGDSEAQSVCKFGITEMTLRRNADNATT
EPKS
Download sequence
Identical sequences K3WVD4
PYU1_T008932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]