SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WVH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3WVH5
Domain Number - Region: 9-85
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0244
Family PH0223-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WVH5
Sequence length 118
Comment (tr|K3WVH5|K3WVH5_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T008973} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MVPNGSKTDVSSNKRKLSTILFEVGVLFHSVIIGIGLGVTTGTSFKTLLAAITLGTIESP
RNVLMMDFVFAVATPVGVVIDILIRSSYSSMSVTGLWVHSMLNCIAAESWCTRVSSSC
Download sequence
Identical sequences K3WVH5
PYU1_T008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]