SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WVP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WVP9
Domain Number 1 Region: 78-189
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000115
Family Ubiquitin-related 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WVP9
Sequence length 633
Comment (tr|K3WVP9|K3WVP9_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T009047} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTDREQQRVTAEGIASAAPREYEPANVGRATAEAQATPMVAAEGTSQSAASAGKVDEEET
KMAAAANNAPTQIDGNDEEKMVVVHLKFIGDRERVSVRCSPTIVIADLKQKVLAAHAQLE
QQQQQSDSTAAEDANREQESVSIATLRLIYKGKVMKDDHTLALYNFVHEDTIHAVFGRPQ
ASSPSQNSGVAHGDASTATGPTAMSPATATRTSSGGVATTSVQDYGNGLRVGQISIDTDA
DSPLPDLGNLINSMLSSLGGSSGSLPDGATASIRIFSDPSALGPLSSDATTNSASSNLSS
TSSTTVSAATTSTSTTAGPVRPTVATAPPAVTTPSTVATTDATSLLNQAASLRRLLPAME
LAPLSRPPELSLEMYNLGNALREAGDTYLAVHRQLQFVVTRFLSENNLNESERLRLRTRV
HQLVPILEHIASMSRAVARNLDSSSYYGPGSQTPTTSGVSEAPAASSVSTPTAPSPAATT
ASAPPPSDPSVNVSPTVNIFGGGNGHAGGIAGIGSSIAEILQAVNNFRPGNMPPSGAPTT
AATSDGTTTSTAQDNSAGGLGGLLNLVSTLTGARPVQPAAPRPSTSVSSAPATSSQPSAN
FNQPLSDLFAQVMHDMDTLDEWDPEVTEQLLKR
Download sequence
Identical sequences K3WVP9
PYU1_T009047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]