SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3WWK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WWK9
Domain Number 1 Region: 17-103
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000167
Family Homeodomain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3WWK9
Sequence length 308
Comment (tr|K3WWK9|K3WWK9_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T009357} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MRAQADRNACFCLRSKDFTLAQIAHALDICARTVHRWLKGESAAARPLNRNHTRKLTSLQ
EERLIEFFLDKNTSRLRDGVAFVAQSFNLCVSERTLGRILHRHRLSFKRAVSAYHEADRA
RQQVFLANLPRDSTKSWIALDEAAFFLNHSRKYAWSKRGTPAVVDRPSNRGRMHSLILTT
SPDGVVDWRLIQDSVDSLRFHAFLSGLPGDTNVLLDNCATHHASHVLVKQGKTTVSQVAR
SKQMTLNYLPPYSPQLNPVELCFNLIRTHVNRTAPRTLGSLHKCIQTAIRGLTPAVCRSM
FRKCLLIG
Download sequence
Identical sequences K3WWK9
PYU1_T009347 PYU1_T009357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]