SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X023 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X023
Domain Number 1 Region: 171-385
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.13e-32
Family DNA repair glycosylase, 2 C-terminal domains 0.0000256
Further Details:      
 
Domain Number 2 Region: 61-170
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.35e-19
Family DNA repair glycosylase, N-terminal domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3X023
Sequence length 425
Comment (tr|K3X023|K3X023_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T010572} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
GTKRKASTVAASPEPPAYVRIKAELPTTKNNHGNIHVKHETLASIPVKTEEEGDASGGAL
QWHRLCSPQELSCKLTLASGQVFSWQYHAHACEWSGVVGNYVFALRENNQIVEYRCLHPL
QLPPQEAHAILTHYFRLDTEAAPLYQAWTTLDDPMAQLIRSLPGHRMIRQDPVECLFSFI
CSSNNNIQRIQQMVGKLRATYGTHLCTVDAVSLMPISPDSKLSSSKEVAAISYYSFPSPE
TLTTKCEEATLRTLGFGYRAPFITKSSQQLVALGGIEYLHQIRDWKPQKSADVNAIDEMD
EYQAKLMVFAGVGRKVADCIALFALERLDAIPVDTHVWQIACREFDPSLVDKKSITPSVY
KSVGDHFRRRFSPFAGWAHSVLFTGDLTAFQSHLPTDMQKKKKNVKTQVKKKVVGRIKAP
GKKAR
Download sequence
Identical sequences K3X023
PYU1_T010572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]