SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X0M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X0M4
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.73e-22
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 133-157
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000183
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  K3X0M4
Domain Number - Region: 182-206
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 101-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000222
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X0M4
Sequence length 457
Comment (tr|K3X0M4|K3X0M4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T010773} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MRDNDSQKIIVVGIPKTMDDSALSELFSGFGTVADAKVVLDANTKQSRGFGFVTFTAGSA
MRKAIQDMNKKVVEGRTLNVRQLVPKDKFQSEKKDDASQDPSKRPCWLLRKGKCTKGDQC
PFSHETKNGEFGSCFEFMQTGECKRGDKCIFSHGSRENADSNDSESTQAKPREAPLKQEG
GEQKRVCFAFQKGKCHRGKKCLYLHEKVPEMVNDQPVVPPTKQEAAPAKRSEFEVVAPVE
AGKKRSRDVDSHDDDDGNEQEVDDDETGSEDDNDEEDEEEQTPQQKTAPARAAPPARASR
QSKPAEKRPRSEDAKPFEKRQRPENGKPFVKREYPAKNGDSKDLSKYGGNGYAQRYTEKQ
LKQKKQNNKNALQRQNAKNRPKGPQQAQPQRPKRAEAVDMGAAFDSDDDRKPRGKKRVAD
KAQQKANREKLQQERKVKRDAKKSALSRLQTKESIEL
Download sequence
Identical sequences K3X0M4
PYU1_T010773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]