SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X134 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X134
Domain Number 1 Region: 255-331
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000217
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.074
Further Details:      
 
Weak hits

Sequence:  K3X134
Domain Number - Region: 48-203
Classification Level Classification E-value
Superfamily Bet v1-like 0.0203
Family STAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3X134
Sequence length 572
Comment (tr|K3X134|K3X134_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T010933} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MVSDMYSSNGRRVPLIQLTPSEQSHYDAVVSDVLQAAIKEYAGFQGFIDTDDWAYVRRRK
QMSVYRSLQPCDDPRATVMVGTGLIPGTLEDVMDGLYCDTTSELRGVKTFIKYKFLDGAV
LNVSERRSPQAPFRFAGIKWTAATAAWGIAKNRDLLTYDRMGTITDRQGNELAYHVLTSI
NRPEWPANNIKGIQRTETTTCYLYRRHKHRVVQCFMWGKIYDINNSGPIVQRIAEYVAAS
TWLNVVRSVESAEAKKLSKLMLRANERQSAATKACHVCYKNTSRFGSSLIQCAGCCQMTC
KACSMDKKIFQIDKKTNKPMEDRFCKLCANKVVAKKAKSPQRERRDRIDSAPVEVGIPTQ
RDRWDSAPVSLGVAVMDGFQAEQIPTRKGESKSMWSQSTSTSSSFDEGELLRSSNERPST
PESRSKAKQPTGKPKAKTKPDFASSIYFSTASFSSIASSSSVSSASSVSSSSTASSISSM
SERDSPPEPSRSTKPKKVDDDLEMRRTTGLGSFDLEMDLLGAISDMQRQTSSSESSLSQA
RHDFSRTRVRERFLTDLYVSPPPSPTQEGFFA
Download sequence
Identical sequences K3X134
PYU1_T010933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]