SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X194 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X194
Domain Number 1 Region: 116-232
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.03e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 238-353
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.98e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0039
Further Details:      
 
Domain Number 3 Region: 29-92
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000017
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0066
Further Details:      
 
Domain Number 4 Region: 470-527
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000196
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0098
Further Details:      
 
Domain Number 5 Region: 387-430
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000235
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3X194
Sequence length 566
Comment (tr|K3X194|K3X194_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T010993} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MASGKATKGGVVYDVGSWRLGDDGSIYRYGRLKYSNGDIYDGEWLNGKRHGKGMLKFAEG
GSYIGEFGENVYHGFGLLTIPKSQHALTKKWIPGERYEGEFAQGRKHGKGTAKTRDGDSY
DGFFIDGYYHGKGTCAYANGDVYDGNWVHGKWQGHGELRFRDGSRYVGEFHQGVYHGFGQ
FLHGSGGKLGSYVGHYVQGKRHGKGLRVFGSSDKKQYEGEWEEDEPHGVGVVECATYKLV
GQFVRGKECGHGAMSFANGESYEGYFEDGFFSGLGTYVHRDGGKYEGHFVKSKRHGKGRR
VFANGGQYDGDWADDKMHGRGRLTRKSALPTGKGTLVYEGAFEWGAQTGEAVISFTYTPF
DSTTRFEWTDEYEFPLQSEFWHCGRGASTYHGQVLRGNFHGYGVLRSPDGKVWSGEWMHG
KMTGVGERIYFPLEVAAILEQERERNQGFQDEENERQVPTLGTNLYKILSYEGEFLENVR
HGDGHVLYANGDRVLGPFVKGFAHGVVEYRFAGGGKSRFAEFHHGARARWLTEAEEDAIR
AQVREREQAQETETSRQKSIIRALIA
Download sequence
Identical sequences K3X194
PYU1_T010993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]