SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X1R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X1R9
Domain Number 1 Region: 1-244
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 6.8e-97
Family Tubulin, GTPase domain 0.00000000134
Further Details:      
 
Domain Number 2 Region: 246-435
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.62e-84
Family Tubulin, C-terminal domain 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X1R9
Sequence length 451
Comment (tr|K3X1R9|K3X1R9_PYTUL) Tubulin alpha chain {ECO:0000256|RuleBase:RU000352} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MREILSIHLGQGGIQVGNSCWELYCLEHGIQPDGQMPSDKTIGGGDDAFSTFFSETGAGK
HVPRAVFVDLEPTVCDEVRTGTYRQLYHPEQIISGKEDAANNYARGHYTIGKEVVDLVLD
RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQVSSA
VVEPYNSVLSTHALLEHTDVAVMLDNEAIYDICRRSLDIERPSYTNLNRLIAQVISSLTT
SLRFDGSLNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSVFEPAS
MMAKCDPRHGKYMATCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPP
AVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVSAETAEGEDEDFGEEY
Download sequence
Identical sequences K3X1R9
PYU1_T011168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]