SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X230 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X230
Domain Number 1 Region: 93-213
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.28e-17
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.013
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000138
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3X230
Sequence length 296
Comment (tr|K3X230|K3X230_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T011279} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MGMNFKVTFSNGTSIKLLGLADDITLDELRAELFAKTQIPPEEQHGYPPKPLVGEGTNTL
QLLGIRSGSVLVLKEAPAGSSSGPATPSTVFLRRVVPADNSCLFNAIGYALGKGKTGNAN
VMRQCIKDTILANPDMYSDVFLGRPVYEYCAWIQDEKSWGGEIEVSILSQYYKVEMVVFD
VTSMSRLCYGEDQGFSQRMFLLYDGVHYDLVVESPSKTAPESRDTALFPINDFSKVERAS
EVAVEAHQNHEYTDLNRFSIQCLVCRQGFTGQREAQVHAEESGHREFGEVRPSRQQ
Download sequence
Identical sequences K3X230
PYU1_T011279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]