SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X2L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X2L5
Domain Number 1 Region: 40-186
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.44e-39
Family Thiamin pyrophosphokinase, catalytic domain 0.0000909
Further Details:      
 
Domain Number 2 Region: 196-275
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 2.75e-22
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X2L5
Sequence length 276
Comment (tr|K3X2L5|K3X2L5_PYTUL) Thiamine pyrophosphokinase {ECO:0000256|PIRNR:PIRNR031057} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAISSSTKTHSNLFWTDPAEFRASVPRLAVLLLNAPHGSWHIKKQIGPHSKIHANELFWN
LWSNAHITVCADGGANRLYDRSVRVEALDVVRPQYIKGDLDSLRDDVREFYAQKGTTIIQ
DPDQDTNDLDKCLQLIHDLQEQQQGVENKGKFSVMIFGAMGGRFDQEMQSINALFRWSER
FQQIVLLSKETTARLLLPGIHHVIEPNFHFEARTCGLIPIAGACTSTTTTGLKWNLNGQE
MKFGGLVSSSNHVDDAHDAVHVESSHPLIWTTELKK
Download sequence
Identical sequences K3X2L5
PYU1_T011464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]