SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X3U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X3U1
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-34
Family Ubiquitin-related 0.0000249
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.97e-20
Family Ribosomal protein S27a 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X3U1
Sequence length 156
Comment (tr|K3X3U1|K3X3U1_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T011890} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MQIFVKTLTGKTITLDVEPSDSIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKQYSKPKKIKHKHRKVKLAVLKFYKVDDNGQIKRLKKE
CPSPGCGGGVFMATHFDRHYCGKCHVTYQFQNEDSA
Download sequence
Identical sequences K3X3U1
PYU1_T011890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]