SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X4H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X4H3
Domain Number 1 Region: 230-543
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.9e-61
Family Histidine biosynthesis enzymes 0.0000000119
Further Details:      
 
Domain Number 2 Region: 4-218
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.75e-48
Family Class I glutamine amidotransferases (GAT) 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3X4H3
Sequence length 547
Comment (tr|K3X4H3|K3X4H3_PYTUL) Cyclase {ECO:0000256|PIRNR:PIRNR036936} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MVQVTVLDYGAGNVRSVKNAIRAAGHTFKDAQSANDIRNAEVLVFPGVGHYREAMEFLNA
KGYTDVLREYIQQDKRFLGICLGMQTLFEGSDECPGLKGLGVIKGTVQLFPSDTIAVPHI
GWNGLKVWKKSSLFAHLPQIEEHDATKVYFVHSFRAIKTEKNASWVLTTTNYGDYEFISS
VQKGNVMATQFHPEKSSTIGINILKGFLENIPKVDHDVAIPDAGAQPATKLSKRVIACLD
VRTNDQGDLVVTKGDQYDVRETSDDGAVRNLGKPVDLCTRYYKEGADEVTFLNICSFREQ
PIGDMPMLKVLEASSQQVFVPLTVGGGIREYIDDKQQKFSALDVASRYFRSGADKVSIGS
DAVYAAEAYYARGKKGDGESAIETISGVYGKQAVVVSLDPKRVYVASFYDENAKGHTVVK
LNKPGPNGEEYCWYQATVRGGREARDIDVVQVAQAVEALGAGELLLNLMDMDGQKDGYDL
NLVKLVKDAVTIPVIASSGAGKPEHFTQVFKETNCDAALAAGIFHRKEVSIQEVKDQLHA
DSISVRL
Download sequence
Identical sequences K3X4H3
PYU1_T012122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]