SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X6C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X6C6
Domain Number 1 Region: 739-1037
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-67
Family Tandem AAA-ATPase domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 484-737
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-55
Family Tandem AAA-ATPase domain 0.0000695
Further Details:      
 
Domain Number 3 Region: 291-382
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000746
Family Chromo domain 0.007
Further Details:      
 
Domain Number 4 Region: 383-475
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000187
Family Chromo domain 0.006
Further Details:      
 
Domain Number 5 Region: 4-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000753
Family PHD domain 0.003
Further Details:      
 
Weak hits

Sequence:  K3X6C6
Domain Number - Region: 1154-1199
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0156
Family Myb/SANT domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X6C6
Sequence length 1997
Comment (tr|K3X6C6|K3X6C6_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T012775} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MADDDANVQYCVCQQVDSGIMIECIRGTGGCNSWVHPSCCGLILTQDELEAIDSYICPLC
ESPSDDYSKMKALNTKLANRLAKKERKRKLAEQMGSNASNDEKSKKSSSTSGSAKASSSS
TASGGAAPSSAKPKTKRKWTCKHCAHENTEREATECDACHLPRKSKSTNSSSSSKKKSSS
SSSGMKEKEKKKKHKHSSAKGDGSDANAGESDRRRSRRESNKKKKSYHVPNSDEDLSSGT
DDDGQKMKHKRRGKKRRREDEDDDGANGLFDSESDEAEFQVDLVRKRKKQEIQEQYTPTS
MIIERIMGVRKREVVEAATGPPPDSAAASIFAPRTVTTIITEYYIKWKGFSYLHCSWESL
EVLLEIDPNNKQRIKRFHEKEQHHSQHHHQQKPFLEGGDEDNEMEYFNPEYMEIHRVLAD
RKETPMPPDPSTPDAPLDDGVRYLVKWRILPYTDATWERACDLKDDIAIQRYKKFLEVPP
KEEWEPLPRPTLREYRKLEESPLFGEDRTLSLRAYQLEGLNWLIWNWYNERPSILADEMG
LGKTIQTLAFLDRLRFSENIMSRGPFLVVAPLSLIAQWQNECETWTTMNCIVYHGNSDSR
ELIRDYEFYYPDSQNKPDKTKPYRFNILVTTYEVAIKDISILTKIKWRCLIVDEAHRLKN
QASRLVEQMRSLHRDHCVLLTGTPLQNKTEELWALLNFLDGKSFPSVQDFLEKFGDLHEA
QQVADLHKMLKPYLLRRVKEDVEKSLPPKEETIIEVELTPVQKQWYRAIYERNTAFLNRG
GNPNNVPNLMNVMMELRKCCNHPYLNNGVEDILSEGLVSDAQRHEMMVKCCGKMVLIDKL
LSRLKEGGHKVLIFSQMVRVLDIIEDYLRYMGYLHERLDGNIRGNDRQAAVDRFVKPEYN
RFVMLLSTKAGGLGLNLTAADTVIIFDSDWNPQNDLQAQARAHRIGQTHSVKIYRLITRK
TYEMHMFHKASLKLGLDKAVLTHMRRENEDQKEGKKKSSKAEESKEIDELLKRGAYDVFR
DDDTAAEQFCAADIDQILQRSSQVVQYEQQAKSSFSKASFVSATTSDDIDIDDPDFWKKA
VGLTEPDPAELADDVPLQRKRTRVSRFGATGSMFDSDGDEDDELDKKDKETEKKEREREK
ELEKERLAEEKNQPRDWTLNGRDRLQRALMHFGFGRWEIIRSQSGGSRTVDEVEQFAREF
IYVLGLSSVESLTSTSKDDSSFIKSLVRASLYAQKEHLVNEEEIPPVLKDEEFVLKLKQG
GARRVLIRLDMLVRLQRLVAKACDKLDAEHYAEQEQNKHNGDQQMEGKSNEEEKERTPLP
SATADADERVAYHGVSKVMAKIELVDVGERPSWTLITPWWDQEADRNLLMGVFLHGYGRV
AQILSDPRLRFAQLEKAEEEAEAKLAAAVSDEKSPETQSNDAATDASTSPVKTEDDDIKM
SDAESDDESSTVNGDDDDADTKSQTGSTSGSTSVKGSATSAPVKKEDNSSEASEKKFKQP
EVQQMNRLLFWLLSAEDIKRHKELESYKKERAGIEQQRQVTLEKKQRVVSLRRVELKAMQ
LAQVDMLRHMSVLRNAKELPDAVIAQKIKQKDWTKEERRTLSYLIGMYGAPRILAKNSIS
AANDGSVSRDNVLSRPFAWQTDSVSWMNIVRWGKLNKTAELARRFFEEKFLPKCIEVANM
KADPLASDQRATALADLIGIEFVDAHEGVLAHGLKAKHQAWVTLRRIQLLQDVLDILSTR
AQELVAYLRSGSDTLVQDMPVWWCPWIHDLALFHGMARYGIYGWENIVLDRQLPFHREAR
SEHIRAVFLEGTDSFAPLYRHHFDSEGSMSAWFDRVVEEFPSFSVLERKVQRICTDFIGN
DNELFRGERYHEPEYRREFSIPASTNCLEISVMQQIKKRDAPVDRSVVAPAIGNVSTALA
HSDGSQLTSAESKARRREFLERAIAVHAVGASVAPRSDVATGSITTTTTLQSMGSAHDTA
HEPKPTTSQIPIQMLMS
Download sequence
Identical sequences K3X6C6
PYU1_T012775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]