SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X837 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X837
Domain Number 1 Region: 78-152
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.33e-16
Family Canonical RBD 0.0026
Further Details:      
 
Domain Number 2 Region: 926-980
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000012
Family Canonical RBD 0.027
Further Details:      
 
Domain Number 3 Region: 482-530
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000407
Family Canonical RBD 0.011
Further Details:      
 
Domain Number 4 Region: 614-658
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000231
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X837
Sequence length 982
Comment (tr|K3X837|K3X837_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T013386} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MADANVAVHAPPSLYPPPEDDAAPPHAHTQDRSVDDTLPQTSAPPATAEASAGTSSSRSQ
SPSPSAADRTRLFIVCGRGRKAEDLRLLFSSCGAIKHLYFALDRSNKSRGFAFLEYEDPS
CAISAIDKFHQLRLDDGHVLKVTIAREKPVIATGKLKRNQQSSHEPRSDSESNSEESHFP
GKRQRSSPPTVSSSTMPAFSRRRTRTKDDEEGNDYKKMHKDETPMQKEAHRGPKITTAQV
PDIASSAADADVKNLLDDMISAIELGAQCTSIAKQRDLASAAAHRFRKQQHRVEREKRPS
ATEESSTDQLTSSISSFTLDATTCSELAKASQFASAASVMSFPQRTERATLLRRRRQSTD
DSDSSLEDVSDTSMSRRKRSNTSHRDSPKWPTTPSPQLPIQRDELELSPSPSLFSPSSST
KKQCKRQSSDQSADVSARSSKQRVTNSRQARMTTDLSATLVERKKTDSPLQIPRSKLFFV
STHKELKAMFAVYGDFEYVEIVKSFGRIKTMAYIKYSDPKTASSVLESFQEDVGRDEEQG
HGGFMKLSLADENLSVTPHLPSRLLHPHGSAFPPAMQPSAASLLEDQTAQEKLWLLILHD
RSLPSQIISSRVSSCPGMEFVDIKVFRSTGESQGVAFVKFEKETQATEAAAELHQLELPA
GSGKFLQAIVILDPSLFSTIHGGPQGQHLGARSMEQGDLRGNEPRVSGGEDVDVSVVEAR
FAHLMRSNDHYNAYPPTARAPMLTEEAAAYQYPMGAPFPAMVPPMHGSQYPGVHMQQLQP
AYGLYPPQQFVQYPSQQLSQFAYVPEASWSSTPSPPPYYHPAHAVNVAHAPAYPGPEYYQ
PSAFPAQLVCPVTSTPDNGTSAQSVVPEATPMSTVASTSEGADGMQSIIISSCRPLELMA
VVKALDECSGVVAITKDGDGSEAAFVVEFSDAAQAMEAVTKLDGKMCNGKKLRVGPMHSS
GKTTRAASSRRKRQRVDQRNRK
Download sequence
Identical sequences K3X837
PYU1_T013386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]