SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X8D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X8D5
Domain Number 1 Region: 28-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000342
Family PARP-type zinc finger 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3X8D5
Sequence length 127
Comment (tr|K3X8D5|K3X8D5_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T013484} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MATEMEMPPPPPPRARGRSAWSRCDEAVARIAPTSTTTCQVCSQSIAQGEWQLGVMFIHV
EGFMLMEWYHLQCSFCIPGGGLQDVLETVQSEMTSAQKLQFQAAYEKLVTSGGNEGPLAM
ASATMVS
Download sequence
Identical sequences K3X8D5
PYU1_T013484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]