SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X8N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X8N3
Domain Number 1 Region: 6-139
Classification Level Classification E-value
Superfamily Bet v1-like 9.9e-25
Family AHSA1 domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3X8N3
Sequence length 142
Comment (tr|K3X8N3|K3X8N3_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T013582} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MSEASVQVTVSALVRAPVESAWEHWTTPASITQWNAASDDWHTTKATNDLQVGGQFSSTM
AAKDDSASFEFSGTYTAVEPLKRIEYVLDDHRRVSITFTASSDAETLIEETFDTEATHTV
EQQRSGWQAIMDNYKKFTEAQQ
Download sequence
Identical sequences K3X8N3
PYU1_T013582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]