SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X8V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X8V4
Domain Number 1 Region: 1144-1405
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-71
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 251-308
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000182
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 870-944
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000196
Family DEP domain 0.018
Further Details:      
 
Domain Number 4 Region: 60-207
Classification Level Classification E-value
Superfamily PH domain-like 0.00000308
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3X8V4
Sequence length 1412
Comment (tr|K3X8V4|K3X8V4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T013653} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAAQESGMAGVVVMEAGSAAHVDYDDVDTIDVDGDSDKGSSAADVDADEAKSAAANDEAP
STGPEQSDDRNSSSSQQQQRSSESGRSTNTTTSDSGNALGAEQDGFGMKGYLSMRDEGLT
YHRMKRFYCRCVGLNFCRFSTREAASALINAAFSAEVHKVESWDGKGLWHTYRNSFKLYF
TNGAVFNIDADSEDDKKKWLAYVRTALKGAEESITKLKTQTEIYPNILLLSLGNLGLADK
KHAPPKFKNQPTCCHPKCNLRFDSAKRQHHCRNCGGSVCSDHSLRSATLRHYSINDSVRL
CTGCYRVQRFMVWLSMILQRLSTAQVEGVKKPALSKADEEEVEALQTLLSDPAFGISDII
QVLHLHRHGCDEAYALAVNKLLELSTTNLPDFEFFLPEFFQLWLTVDWARNNIKAALLFR
VVCYAAQLHIRFATSLYWLARAAVDDSCGWGFGQSELLIPEYLFRKFSLCKLLMINLEMQ
ISQSDWSFAVDRDIPAPDLQAQMIACQFERLRVLTRATMSNVISPLGELCDAINACAIPE
EYLLASKAFIQSRPASDGQEWRVFNTQIKFVEELCDMTERLRHCAPEQRKEALKQELQRI
TLPEEAFCPLGSCEDALQRFITIARTEGTVFTTRARAPTLIFFEVEMLTYLAASSPWLQR
ARSLTATSYVEGFQDNSGSQSEASLLGSTGAPSAFNSSLKESKNAIEMATSSDIAQALEL
NTLSENGGALSSQVASKADEDQQQAAAKLNDSRTTNEEELDSEEREEARDRVSSNPVPVL
ATVGKKKSGKKTKRGRSGSLVTATTKSLDSIIAACSDTLNSRRKRSMSEGEAFDSYNGYA
QRKSSPLFNEVEKFTKDQLIRMAQNLEIDMLAVYPTSEGVFSGKDVVSWMTQNEIVFDET
HAMWLGGELIDSGAIETATPEPNEADAPPSRKFSASKDATYRLRSESTTIPALRKPKSTG
AANKTETSSVPSELSTPASPSLGAHEPISEENVSPDAHTSANHSDARSVSFSSSPSRSSG
DHRESSSGFQVDTSNTSSTEDRRSTSQRGSFFEKFKPDDALSALHSVEDALQKHVFSHDD
IDDVDKLRDDLLILKEQMEIIHEFVVDKQKQRQSAVGSAFGESFEEKRERLRQSSRHLQL
SQSSNWDCVAFIVKSNDDLRQEVLCLQLIRQFHDIFQSADLPLRLLPYGIIATSASTGMI
EYVKNATSLDGLKKRRGYTTLANHFLKTYGDVDSAPYKTAMTNFVRSMAAYSLACYFLQI
KDRHNGNIMIDSEGHVVHIDYGFILGIAPGGRFSLETAPFKLTAEMVEAMGGTQSEYFKA
YVIFLIQGFLALQQHADTVLMMIAIMAQESSCPCFLSQNPRDILSSTKRLFQLQMNQSQV
IKHVLQLVRRSHNSYRTRQYDVFQRMTNGIVP
Download sequence
Identical sequences K3X8V4
PYU1_T013653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]