SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3X937 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3X937
Domain Number 1 Region: 206-312
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-27
Family Canonical RBD 0.0000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3X937
Sequence length 324
Comment (tr|K3X937|K3X937_PYTUL) Eukaryotic translation initiation factor 3 subunit 4 {ECO:0000256|HAMAP-Rule:MF_03006} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MVVSGSRWGDDDDDFLPQRTESEPDQNGVRTIVEWKYNEDGQKVKVTKKVKKVTEVTRVS
KRALERKNWEKFGAAKNDGDNSNVTYQSYEEVRLEDPNADQVLPGEKKEEENIFAGVKNS
SIVVCRHCGMVGDHWTLKCPYKDTPADELPSDLSTRAAADAESGAAAAAGGDAGGSALSN
AFGSGKYVPPSLRGRVPEGGGGGGDEEDRDFATLRVTNVSPDTREDDLKELFRAFGPVAR
VYLAKDRETFESRGFAFVSFMHREDAERALNKLQGYGYDHLILKLEWAKPSNKPKETDAG
SMGTTFRSGYGKALPQNIAPPPRK
Download sequence
Identical sequences K3X937
PYU1_T013736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]