SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3XA80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3XA80
Domain Number 1 Region: 240-321,350-427
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.55e-16
Family Canonical RBD 0.0018
Further Details:      
 
Weak hits

Sequence:  K3XA80
Domain Number - Region: 133-171
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00217
Family Canonical RBD 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3XA80
Sequence length 433
Comment (tr|K3XA80|K3XA80_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T014129} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTTSKVLYFDQLPPHWTARDLAEALAPLAEAPQITRSVFLHKRNALYAGFHPSSHEIIPS
APIPALAEIVDLDTAVRLMETLTATPLTIDHADGTSAVVAVSYSKNQELHDRIPPPSGHG
RHRRNHADINKANRILLVTVQNPTYPITTELMHGIFKGYGAVEKIVIFVKPIGLQQELIV
KENGLRTRDFTNPDLPAASDGRDTAASPVADLDIFGQSLPAGVMPAIAVSGRDAVVSPVL
LVCSLREKVTCDNLFNLFSCYGNVVRVKKLSAKPDHALVQFLNPLAAQSALIHLRGYTLL
GKSMEISFSKYMYISNRAGSTENPLVKEYNHLPNRFTGKAAMSLGKHVYSPTKLLHLSNF
DESTAIEMLKTHLGGFHGGDHCKVKTFMSPSGHLQALAEFASVDTATNVLAQAHNSLLGA
KPLKFAFSNRSFH
Download sequence
Identical sequences K3XA80
PYU1_T014129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]